Page 1 of 1
16 (3pts) Three polypeptides, the sequences of which are represented using the one-letter code for their amino acids, ar
Posted: Wed Jul 06, 2022 10:29 am
by answerhappygod
- 16 3pts Three Polypeptides The Sequences Of Which Are Represented Using The One Letter Code For Their Amino Acids Ar 1 (40.76 KiB) Viewed 13 times
16 (3pts) Three polypeptides, the sequences of which are represented using the one-letter code for their amino acids, are present in a mixture after protein purification. Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKROHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3: PHLLSAWKGMEGVGKSQSFAALIVILA a) Determine which peptide would migrate most slowly during gel filtration chromatography. b) Determine which peptide would migrate the fastest during the gel filtration chromatography