- 16 3pts Three Polypeptides The Sequences Of Which Are Represented Using The One Letter Code For Their Amino Acids Ar 1 (40.76 KiB) Viewed 11 times
16 (3pts) Three polypeptides, the sequences of which are represented using the one-letter code for their amino acids, ar
-
- Site Admin
- Posts: 899603
- Joined: Mon Aug 02, 2021 8:13 am
16 (3pts) Three polypeptides, the sequences of which are represented using the one-letter code for their amino acids, ar
16 (3pts) Three polypeptides, the sequences of which are represented using the one-letter code for their amino acids, are present in a mixture after protein purification. Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKROHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3: PHLLSAWKGMEGVGKSQSFAALIVILA a) Determine which peptide would migrate most slowly during gel filtration chromatography. b) Determine which peptide would migrate the fastest during the gel filtration chromatography