16 (3pts) Three polypeptides, the sequences of which are represented using the one-letter code for their amino acids, ar

Business, Finance, Economics, Accounting, Operations Management, Computer Science, Electrical Engineering, Mechanical Engineering, Civil Engineering, Chemical Engineering, Algebra, Precalculus, Statistics and Probabilty, Advanced Math, Physics, Chemistry, Biology, Nursing, Psychology, Certifications, Tests, Prep, and more.
Post Reply
answerhappygod
Site Admin
Posts: 899603
Joined: Mon Aug 02, 2021 8:13 am

16 (3pts) Three polypeptides, the sequences of which are represented using the one-letter code for their amino acids, ar

Post by answerhappygod »

16 3pts Three Polypeptides The Sequences Of Which Are Represented Using The One Letter Code For Their Amino Acids Ar 1
16 3pts Three Polypeptides The Sequences Of Which Are Represented Using The One Letter Code For Their Amino Acids Ar 1 (40.76 KiB) Viewed 11 times
16 (3pts) Three polypeptides, the sequences of which are represented using the one-letter code for their amino acids, are present in a mixture after protein purification. Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKROHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3: PHLLSAWKGMEGVGKSQSFAALIVILA a) Determine which peptide would migrate most slowly during gel filtration chromatography. b) Determine which peptide would migrate the fastest during the gel filtration chromatography
Join a community of subject matter experts. Register for FREE to view solutions, replies, and use search function. Request answer by replying!
Top
Post Reply

Return to “Archived Questions & Answers”