4. (2 points) The amino acid sequence of calcium sensor protein, neuronal calcium sensor 1 , is shown below. Using the s

Business, Finance, Economics, Accounting, Operations Management, Computer Science, Electrical Engineering, Mechanical Engineering, Civil Engineering, Chemical Engineering, Algebra, Precalculus, Statistics and Probabilty, Advanced Math, Physics, Chemistry, Biology, Nursing, Psychology, Certifications, Tests, Prep, and more.
Post Reply
answerhappygod
Site Admin
Posts: 899604
Joined: Mon Aug 02, 2021 8:13 am

4. (2 points) The amino acid sequence of calcium sensor protein, neuronal calcium sensor 1 , is shown below. Using the s

Post by answerhappygod »

4 2 Points The Amino Acid Sequence Of Calcium Sensor Protein Neuronal Calcium Sensor 1 Is Shown Below Using The S 1
4 2 Points The Amino Acid Sequence Of Calcium Sensor Protein Neuronal Calcium Sensor 1 Is Shown Below Using The S 1 (35.05 KiB) Viewed 45 times
I need help with 1, 2, and 3 but mainly 1. I included 4 in casesome of that information is needed. Please show work so I canunderstand.
4. (2 points) The amino acid sequence of calcium sensor protein, neuronal calcium sensor 1 , is shown below. Using the server peptide property calculator, Peptide Properties Calculator determine the extinction coefficient for this proteins and molecular mass. The Extinction coefficient is equal to 19,180 cm−1M−1 and the molecular mass is equal to 19,728 g/mol. equence for neuronal calcium sensor 1 . sp|P62166-2|NCS1_HUMAN Isoform 2 of Neuronal calcium sensor 1 os=Homo apiens OX=9606GN=NCS1 IATITEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGdPTKFATFVFNVFDENKDG IEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVEL EEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV ou prepared 1 mL of neuronal calcium sensor 1 protein sample with absorbance at 280 nm of 0.2. 1. What is the concentration of this sample in molL−1 ? 2. How many microgram of this protein do you have in your sample? 3. How many molecules of neuronal calcium sensor do you have in your sample?
Join a community of subject matter experts. Register for FREE to view solutions, replies, and use search function. Request answer by replying!
Post Reply