4. (2 points) The amino acid sequence of calcium sensor protein, neuronal calcium sensor 1 , is shown below. Using the s
Posted: Fri Jul 15, 2022 5:15 pm
- 4 2 Points The Amino Acid Sequence Of Calcium Sensor Protein Neuronal Calcium Sensor 1 Is Shown Below Using The S 1 (35.05 KiB) Viewed 46 times
4. (2 points) The amino acid sequence of calcium sensor protein, neuronal calcium sensor 1 , is shown below. Using the server peptide property calculator, Peptide Properties Calculator determine the extinction coefficient for this proteins and molecular mass. The Extinction coefficient is equal to 19,180 cm−1M−1 and the molecular mass is equal to 19,728 g/mol. equence for neuronal calcium sensor 1 . sp|P62166-2|NCS1_HUMAN Isoform 2 of Neuronal calcium sensor 1 os=Homo apiens OX=9606GN=NCS1 IATITEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGdPTKFATFVFNVFDENKDG IEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVEL EEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV ou prepared 1 mL of neuronal calcium sensor 1 protein sample with absorbance at 280 nm of 0.2. 1. What is the concentration of this sample in molL−1 ? 2. How many microgram of this protein do you have in your sample? 3. How many molecules of neuronal calcium sensor do you have in your sample?